![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Rho termination factor, RNA-binding domain [68910] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [68911] (9 PDB entries) Uniprot P03002 |
![]() | Domain d1xpoe2: 1xpo E:48-129 [122225] Other proteins in same PDB: d1xpoa1, d1xpoa3, d1xpob1, d1xpob3, d1xpoc1, d1xpoc3, d1xpod1, d1xpod3, d1xpoe1, d1xpoe3, d1xpof1, d1xpof3 automatically matched to d1a63_2 protein/RNA complex; complexed with ags, bcm, mg |
PDB Entry: 1xpo (more details), 3.15 Å
SCOPe Domain Sequences for d1xpoe2:
Sequence, based on SEQRES records: (download)
>d1xpoe2 b.40.4.5 (E:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg eryfallkvnevnfdkpenarn
>d1xpoe2 b.40.4.5 (E:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg eryfallkvnevnfdkpenn
Timeline for d1xpoe2: