![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) ![]() |
![]() | Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) |
![]() | Protein Rho termination factor, N-terminal domain [68914] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) |
![]() | Domain d1xpod1: 1xpo D:1-47 [122221] Other proteins in same PDB: d1xpoa2, d1xpoa3, d1xpob2, d1xpob3, d1xpoc2, d1xpoc3, d1xpod2, d1xpod3, d1xpoe2, d1xpoe3, d1xpof2, d1xpof3 automatically matched to d1a8va1 complexed with ags, bcm, mg |
PDB Entry: 1xpo (more details), 3.15 Å
SCOP Domain Sequences for d1xpod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpod1 a.140.3.1 (D:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1xpod1: