![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Transcription termination factor Rho, ATPase domain [89676] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89677] (5 PDB entries) Uniprot P03002 |
![]() | Domain d1xpoc3: 1xpo C:130-417 [122220] Other proteins in same PDB: d1xpoa1, d1xpoa2, d1xpob1, d1xpob2, d1xpoc1, d1xpoc2, d1xpod1, d1xpod2, d1xpoe1, d1xpoe2, d1xpof1, d1xpof2 automatically matched to d1pv4a3 protein/RNA complex; complexed with ags, bcm, mg |
PDB Entry: 1xpo (more details), 3.15 Å
SCOPe Domain Sequences for d1xpoc3:
Sequence, based on SEQRES records: (download)
>d1xpoc3 c.37.1.11 (C:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} kilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmllq niaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviek akrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnvee ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
>d1xpoc3 c.37.1.11 (C:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} kilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqniaq siaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrl vehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggsltii atalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqee lqkmwilrkiihpmgeidameflinklamtktnddffemmk
Timeline for d1xpoc3: