Lineage for d1xpoc3 (1xpo C:130-417)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869938Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 2869939Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
    Uniprot P03002
  8. 2869966Domain d1xpoc3: 1xpo C:130-417 [122220]
    Other proteins in same PDB: d1xpoa1, d1xpoa2, d1xpob1, d1xpob2, d1xpoc1, d1xpoc2, d1xpod1, d1xpod2, d1xpoe1, d1xpoe2, d1xpof1, d1xpof2
    automatically matched to d1pv4a3
    protein/RNA complex; complexed with ags, bcm, mg

Details for d1xpoc3

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (C:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpoc3:

Sequence, based on SEQRES records: (download)

>d1xpoc3 c.37.1.11 (C:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
kilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmllq
niaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviek
akrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnvee
ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1xpoc3 c.37.1.11 (C:130-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
kilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqniaq
siaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakrl
vehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggsltii
atalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqee
lqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOPe Domain Coordinates for d1xpoc3:

Click to download the PDB-style file with coordinates for d1xpoc3.
(The format of our PDB-style files is described here.)

Timeline for d1xpoc3: