Lineage for d1xpoc2 (1xpo C:48-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789905Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 2789906Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 2789939Domain d1xpoc2: 1xpo C:48-129 [122219]
    Other proteins in same PDB: d1xpoa1, d1xpoa3, d1xpob1, d1xpob3, d1xpoc1, d1xpoc3, d1xpod1, d1xpod3, d1xpoe1, d1xpoe3, d1xpof1, d1xpof3
    automatically matched to d1a63_2
    protein/RNA complex; complexed with ags, bcm, mg

Details for d1xpoc2

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (C:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpoc2:

Sequence, based on SEQRES records: (download)

>d1xpoc2 b.40.4.5 (C:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenarn

Sequence, based on observed residues (ATOM records): (download)

>d1xpoc2 b.40.4.5 (C:48-129) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenn

SCOPe Domain Coordinates for d1xpoc2:

Click to download the PDB-style file with coordinates for d1xpoc2.
(The format of our PDB-style files is described here.)

Timeline for d1xpoc2: