Lineage for d1xpob1 (1xpo B:1-47)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506479Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1506522Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 1506523Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 1506524Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 1506525Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 1506555Domain d1xpob1: 1xpo B:1-47 [122215]
    Other proteins in same PDB: d1xpoa2, d1xpoa3, d1xpob2, d1xpob3, d1xpoc2, d1xpoc3, d1xpod2, d1xpod3, d1xpoe2, d1xpoe3, d1xpof2, d1xpof3
    automatically matched to d1a8va1
    protein/RNA complex; complexed with ags, bcm, mg

Details for d1xpob1

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (B:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpob1 a.140.3.1 (B:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1xpob1:

Click to download the PDB-style file with coordinates for d1xpob1.
(The format of our PDB-style files is described here.)

Timeline for d1xpob1: