Lineage for d1xpoa1 (1xpo A:1-47)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649863Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 649902Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 649903Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 649904Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 649905Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
  8. 649934Domain d1xpoa1: 1xpo A:1-47 [122212]
    Other proteins in same PDB: d1xpoa2, d1xpoa3, d1xpob2, d1xpob3, d1xpoc2, d1xpoc3, d1xpod2, d1xpod3, d1xpoe2, d1xpoe3, d1xpof2, d1xpof3
    automatically matched to d1a8va1
    complexed with ags, bcm, mg

Details for d1xpoa1

PDB Entry: 1xpo (more details), 3.15 Å

PDB Description: structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
PDB Compounds: (A:) Rho transcription termination factor

SCOP Domain Sequences for d1xpoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpoa1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1xpoa1:

Click to download the PDB-style file with coordinates for d1xpoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xpoa1: