Lineage for d1xpha_ (1xph A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608265Domain d1xpha_: 1xph A: [122211]
    automated match to d1t8da1
    complexed with ca

Details for d1xpha_

PDB Entry: 1xph (more details), 1.41 Å

PDB Description: Structure of DC-SIGNR and a portion of repeat domain 8
PDB Compounds: (A:) CD209 antigen-like protein 1

SCOPe Domain Sequences for d1xpha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpha_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqt
srsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndn
rcdvdnywickkpaacfrd

SCOPe Domain Coordinates for d1xpha_:

Click to download the PDB-style file with coordinates for d1xpha_.
(The format of our PDB-style files is described here.)

Timeline for d1xpha_: