![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries) |
![]() | Domain d1xpha_: 1xph A: [122211] automated match to d1t8da1 complexed with ca |
PDB Entry: 1xph (more details), 1.41 Å
SCOPe Domain Sequences for d1xpha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpha_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqt srsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndn rcdvdnywickkpaacfrd
Timeline for d1xpha_: