SCOPe 2.08: Domain d1xpha_: 1xph A:

Lineage for d1xpha_ (1xph A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d1xpha_: 1xph A: [122211]
   automated match to d1t8da1
   complexed with ca

Details for d1xpha_

PDB Entry: 1xph, 1.41 Å

PDB Description: Structure of DC-SIGNR and a portion of repeat domain 8

PDB Compounds: (A:) CD209 antigen-like protein 1

SCOPe Domain Sequences for d1xpha_:

Sequence; same for both SEQRES and ATOM records:

>d1xpha_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqt
srsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndn
rcdvdnywickkpaacfrd

Timeline for d1xpha_:

• d1xpha_ first appeared in SCOP 1.73, called d1xpha1
  
• d1xpha_ appears in SCOPe 2.07