Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (7 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.1: Endonuclease IV [51659] (1 protein) |
Protein Endonuclease IV [51660] (2 species) DNA repair enzyme |
Species Bacillus anthracis [TaxId:1392] [141851] (1 PDB entry) |
Domain d1xp3a1: 1xp3 A:2-298 [122210] complexed with so4, zn |
PDB Entry: 1xp3 (more details), 2.57 Å
SCOP Domain Sequences for d1xp3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Bacillus anthracis [TaxId: 1392]} lkigshvsmsgkkmllaaseeavsygattfmiytgapqntrrkpieelnieagrkhmeqn gieeiiihapyiinvgnttkpetfqlgvdflrmeiertsalgvakqivlhpgahvgagad agiqqiikglnevltpdqtvnialetmagkgtecgrsfeeiakiidgvkyneklsvcfdt chthdagydivnnfdgvlnefdkivgidrlqvlhindsknvrgagkdrhenigfghigyk alhhivhhpqlthvpkiletpyvgedkkdkkppykleiemlkngtfdegllekikaq
Timeline for d1xp3a1: