SCOP 1.73: Domain d1xp3a1: 1xp3 A:2-298

Lineage for d1xp3a1 (1xp3 A:2-298)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (7 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.1: Endonuclease IV [51659] (1 protein)

6. Protein Endonuclease IV [51660] (2 species)
   DNA repair enzyme

7. Species Bacillus anthracis [TaxId:1392] [141851] (1 PDB entry)

8. Domain d1xp3a1: 1xp3 A:2-298 [122210]
   complexed with so4, zn

Details for d1xp3a1

PDB Entry: 1xp3, 2.57 Å

PDB Description: Crystal Structure of Endonuclease IV (BA4508) from Bacillus anthracis at 2.57A Resolution.

PDB Compounds: (A:) endonuclease IV

SCOP Domain Sequences for d1xp3a1:

Sequence; same for both SEQRES and ATOM records:

>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Bacillus anthracis [TaxId: 1392]}
lkigshvsmsgkkmllaaseeavsygattfmiytgapqntrrkpieelnieagrkhmeqn
gieeiiihapyiinvgnttkpetfqlgvdflrmeiertsalgvakqivlhpgahvgagad
agiqqiikglnevltpdqtvnialetmagkgtecgrsfeeiakiidgvkyneklsvcfdt
chthdagydivnnfdgvlnefdkivgidrlqvlhindsknvrgagkdrhenigfghigyk
alhhivhhpqlthvpkiletpyvgedkkdkkppykleiemlkngtfdegllekikaq

Timeline for d1xp3a1:

• d1xp3a1 is new in SCOP 1.73
  
• d1xp3a1 appears in SCOP 1.75
  
• d1xp3a1 appears in the current release, SCOPe 2.08