Lineage for d1xoxb_ (1xox B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038069Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 3038070Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)
  8. 3038087Domain d1xoxb_: 1xox B: [122209]
    automated match to d2raxa1
    complexed with zn

    has additional insertions and/or extensions that are not grouped together

Details for d1xoxb_

PDB Entry: 1xox (more details)

PDB Description: solution structure of human survivin
PDB Compounds: (B:) apoptosis inhibitor survivin

SCOPe Domain Sequences for d1xoxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoxb_ g.52.1.1 (B:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

SCOPe Domain Coordinates for d1xoxb_:

Click to download the PDB-style file with coordinates for d1xoxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xoxb_: