SCOPe 2.06: Domain d1xoxa_: 1xox A:

Lineage for d1xoxa_ (1xox A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein Anti-apoptotic protein survivin [57930] (2 species)
   contains a long alpha-helix after the common fold

7. Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)

8. Domain d1xoxa_: 1xox A: [122208]
   automated match to d2raxa1
   complexed with zn

Details for d1xoxa_

PDB Entry: 1xox

PDB Description: solution structure of human survivin

PDB Compounds: (A:) apoptosis inhibitor survivin

SCOPe Domain Sequences for d1xoxa_:

Sequence; same for both SEQRES and ATOM records:

>d1xoxa_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

Timeline for d1xoxa_:

• d1xoxa_ first appeared in SCOP 1.73, called d1xoxa1
  
• d1xoxa_ appears in SCOPe 2.05
  
• d1xoxa_ appears in SCOPe 2.07
  
• d1xoxa_ appears in the current release, SCOPe 2.08