Lineage for d1xoxa1 (1xox A:7-117)
- Root: SCOPe 2.03
Class g: Small proteins [56992] (90 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
metal(zinc)-bound alpha+beta foldSuperfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) 
Protein Anti-apoptotic protein survivin [57930] (2 species)
contains a long alpha-helix after the common foldSpecies Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) 
Domain d1xoxa1: 1xox A:7-117 [122208]
automatically matched to d1m4ma_
complexed with zn
Details for d1xoxa1
PDB Entry: 1xox (more details)
PDB Description: solution structure of human survivin
PDB Compounds: (A:) apoptosis inhibitor survivinSCOPe Domain Sequences for d1xoxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xoxa1 g.52.1.1 (A:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
SCOPe Domain Coordinates for d1xoxa1:
Click to download the PDB-style file with coordinates for d1xoxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xoxa1:
- d1xoxa1 first appeared in SCOP 1.73
- d1xoxa1 appears in SCOPe 2.02
- d1xoxa1 is called d1xoxa_ in SCOPe 2.04
- d1xoxa1 appears in the current release, SCOPe 2.08, called d1xoxa_
View in 3D
