Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) |
Domain d1xoxa_: 1xox A: [122208] automated match to d2raxa1 complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xox (more details)
SCOPe Domain Sequences for d1xoxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xoxa_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
Timeline for d1xoxa_: