Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.6: N-acetylmuramoyl-L-alanine amidase-like [102517] (2 proteins) automatically mapped to Pfam PF01520 |
Protein Endolysin Ply, catalytic domain [142524] (1 species) |
Species Bacteriophage Psa [TaxId:171618] [142525] (1 PDB entry) Uniprot Q8W5Y8 1-180 |
Domain d1xova2: 1xov A:1-180 [122207] Other proteins in same PDB: d1xova1, d1xova3 complexed with cl, glu, lys, so4, trs, zn |
PDB Entry: 1xov (more details), 1.8 Å
SCOPe Domain Sequences for d1xova2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xova2 c.56.5.6 (A:1-180) Endolysin Ply, catalytic domain {Bacteriophage Psa [TaxId: 171618]} msnysmsrghsdkcvgaedilseikeaekvlnaasdelkreghnvktfidrtsttqsanl nkivnwhnanpadvhisvhlnagkgtgvevwyyagdekgrklaveisakmakalglpnrg akatkdlrflnstkgtavllevcfvdrkedanaihksgmydklgiaiaegltgktvaakn
Timeline for d1xova2: