Lineage for d1xova2 (1xov A:1-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889915Family c.56.5.6: N-acetylmuramoyl-L-alanine amidase-like [102517] (2 proteins)
    automatically mapped to Pfam PF01520
  6. 2889916Protein Endolysin Ply, catalytic domain [142524] (1 species)
  7. 2889917Species Bacteriophage Psa [TaxId:171618] [142525] (1 PDB entry)
    Uniprot Q8W5Y8 1-180
  8. 2889918Domain d1xova2: 1xov A:1-180 [122207]
    Other proteins in same PDB: d1xova1, d1xova3
    complexed with cl, glu, lys, so4, trs, zn

Details for d1xova2

PDB Entry: 1xov (more details), 1.8 Å

PDB Description: The crystal structure of the listeria monocytogenes bacteriophage PSA endolysin PlyPSA
PDB Compounds: (A:) Ply protein

SCOPe Domain Sequences for d1xova2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xova2 c.56.5.6 (A:1-180) Endolysin Ply, catalytic domain {Bacteriophage Psa [TaxId: 171618]}
msnysmsrghsdkcvgaedilseikeaekvlnaasdelkreghnvktfidrtsttqsanl
nkivnwhnanpadvhisvhlnagkgtgvevwyyagdekgrklaveisakmakalglpnrg
akatkdlrflnstkgtavllevcfvdrkedanaihksgmydklgiaiaegltgktvaakn

SCOPe Domain Coordinates for d1xova2:

Click to download the PDB-style file with coordinates for d1xova2.
(The format of our PDB-style files is described here.)

Timeline for d1xova2: