SCOPe 2.05: Domain d1xodb_: 1xod B:

Lineage for d1xodb_ (1xod B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [186773] (2 PDB entries)

8. Domain d1xodb_: 1xod B: [122203]
   Other proteins in same PDB: d1xoda1
   automated match to d1evha_
   complexed with gol

Details for d1xodb_

PDB Entry: 1xod, 1.15 Å

PDB Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain

PDB Compounds: (B:) Spred1

SCOPe Domain Sequences for d1xodb_:

Sequence; same for both SEQRES and ATOM records:

>d1xodb_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk
tvvlecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Timeline for d1xodb_:

• d1xodb_ first appeared in SCOP 1.73, called d1xodb1
  
• d1xodb_ appears in SCOPe 2.04
  
• d1xodb_ is called d1xodb2 in SCOPe 2.06
  
• d1xodb_ appears in the current release, SCOPe 2.08, called d1xodb2