Lineage for d1xoda1 (1xod A:10-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673297Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)
  6. 673318Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (1 species)
  7. 673319Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [141431] (2 PDB entries)
  8. 673320Domain d1xoda1: 1xod A:10-123 [122202]
    complexed with gol

Details for d1xoda1

PDB Entry: 1xod (more details), 1.15 Å

PDB Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain
PDB Compounds: (A:) Spred1

SCOP Domain Sequences for d1xoda1:

Sequence, based on SEQRES records: (download)

>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
syarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvvl
ecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Sequence, based on observed residues (ATOM records): (download)

>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
syarvravvmtrddssggwlqlgggglssvtvsktteflvhgerlrdktvvlecvlrrdl
vynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

SCOP Domain Coordinates for d1xoda1:

Click to download the PDB-style file with coordinates for d1xoda1.
(The format of our PDB-style files is described here.)

Timeline for d1xoda1:

Domains from other chains:
(mouse over for more information)
d1xodb1