SCOP 1.75: Domain d1xoca1: 1xoc A:17-520

Lineage for d1xoca1 (1xoc A:17-520)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Bacillus subtilis [TaxId:1423] [142799] (1 PDB entry)
   Uniprot P42061 40-543

8. Domain d1xoca1: 1xoc A:17-520 [122201]
   complexed with zn

Details for d1xoca1

PDB Entry: 1xoc, 1.55 Å

PDB Description: The structure of the oligopeptide-binding protein, AppA, from Bacillus subtilis in complex with a nonapeptide.

PDB Compounds: (A:) Oligopeptide-binding protein appA

SCOP Domain Sequences for d1xoca1:

Sequence; same for both SEQRES and ATOM records:

>d1xoca1 c.94.1.1 (A:17-520) Oligo-peptide binding protein (OPPA) {Bacillus subtilis [TaxId: 1423]}
kpqqggdlvvgsigeptlfnslystddastdienmlysfltktdeklnvklslaesikel
dgglaydvkikkgvkfhdgkeltaddvvftysvplskdykgergstyemlksvekkgdye
vlfklkykdgnfynnaldstailpkhilgnvpiadleenefnrkkpigsgpfkfkewkqg
qyikleanddyfegrpyldtvtykvipdanaaeaqlqagdinffnvpatdyktaekfnnl
kivtdlalsyvyigwneknelfkdkkvrqalttaldresivsqvldgdgevayipespls
wnypkdidvpkfeynekkakqmlaeagwkdtngdgildkdgkkfsftlktnqgnkvredi
avvvqeqlkkigievktqivewsalveqmnppnwdfdamvmgwslstfpdqydifhssqi
kkglnyvwyknaeadklmkdaksisdrkqyskeyeqiyqkiaedqpytflyypnnhmamp
enlegykyhpkrdlyniekwwlak

Timeline for d1xoca1:

• d1xoca1 first appeared in SCOP 1.73
  
• d1xoca1 appears in SCOPe 2.01
  
• d1xoca1 appears in the current release, SCOPe 2.08