Lineage for d1xo2b_ (1xo2 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434513Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434514Species Human (Homo sapiens) [TaxId:9606] [88860] (11 PDB entries)
  8. 1434523Domain d1xo2b_: 1xo2 B: [122200]
    Other proteins in same PDB: d1xo2a1, d1xo2a2
    automated match to d1blxa_
    complexed with fse

Details for d1xo2b_

PDB Entry: 1xo2 (more details), 2.9 Å

PDB Description: Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin
PDB Compounds: (B:) cell division protein kinase 6

SCOPe Domain Sequences for d1xo2b_:

Sequence, based on SEQRES records: (download)

>d1xo2b_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

Sequence, based on observed residues (ATOM records): (download)

>d1xo2b_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
fehpnvvrlfdvctvsretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgl
dflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllq
ssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalprqa
fhaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

SCOPe Domain Coordinates for d1xo2b_:

Click to download the PDB-style file with coordinates for d1xo2b_.
(The format of our PDB-style files is described here.)

Timeline for d1xo2b_: