SCOPe 2.08: Domain d1xo2a2: 1xo2 A:149-254

Lineage for d1xo2a2 (1xo2 A:149-254)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)

8. Domain d1xo2a2: 1xo2 A:149-254 [122199]
   Other proteins in same PDB: d1xo2b_
   automated match to d1jowa2
   complexed with fse

Details for d1xo2a2

PDB Entry: 1xo2, 2.9 Å

PDB Description: Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin

PDB Compounds: (A:) Cyclin

SCOPe Domain Sequences for d1xo2a2:

Sequence; same for both SEQRES and ATOM records:

>d1xo2a2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil

Timeline for d1xo2a2:

• d1xo2a2 first appeared in SCOP 1.73
  
• d1xo2a2 appears in SCOPe 2.07