Lineage for d1xnna_ (1xnn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008552Species Norway rat (Rattus norvegicus) [TaxId:10116] [63622] (6 PDB entries)
  8. 2008557Domain d1xnna_: 1xnn A: [122197]
    automated match to d1e3ga_
    complexed with hyq; mutant

Details for d1xnna_

PDB Entry: 1xnn (more details), 2.2 Å

PDB Description: crystal structure of the rat androgen receptor ligand binding domain t877a mutant complex with (3a-alpha-,4-alpha 7-alpha-,7a-alpha-)-3a,4,7,7a-tetrahydro-2-(4-nitro-1-naphthalenyl)-4,7-ethano-1h-isoindole-1,3(2h)-dione.
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1xnna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnna_ a.123.1.1 (A:) Androgen receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfht

SCOPe Domain Coordinates for d1xnna_:

Click to download the PDB-style file with coordinates for d1xnna_.
(The format of our PDB-style files is described here.)

Timeline for d1xnna_: