SCOPe 2.06: Domain d1xnkb_: 1xnk B:

Lineage for d1xnkb_ (1xnk B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (15 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [186858] (1 PDB entry)

8. Domain d1xnkb_: 1xnk B: [122196]
   automated match to d1h1aa_
   complexed with so4, xs2

Details for d1xnkb_

PDB Entry: 1xnk, 1.55 Å

PDB Description: beta-1,4-xylanase from chaetomium thermophilum complexed with methyl thioxylopentoside

PDB Compounds: (B:) endoxylanase 11A

SCOPe Domain Sequences for d1xnkb_:

Sequence; same for both SEQRES and ATOM records:

>d1xnkb_ b.29.1.11 (B:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

Timeline for d1xnkb_:

• d1xnkb_ first appeared in SCOP 1.73, called d1xnkb1
  
• d1xnkb_ appears in SCOPe 2.05
  
• d1xnkb_ appears in SCOPe 2.07
  
• d1xnkb_ appears in the current release, SCOPe 2.08