SCOP 1.73: Domain d1xnkb1: 1xnk B:1-191

Lineage for d1xnkb1 (1xnk B:1-191)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Chaetomium thermophilum [TaxId:209285] [89272] (2 PDB entries)
   endoxylanase 11a

8. Domain d1xnkb1: 1xnk B:1-191 [122196]
   automatically matched to d1h1aa_
   complexed with so4, xs2

Details for d1xnkb1

PDB Entry: 1xnk, 1.55 Å

PDB Description: beta-1,4-xylanase from chaetomium thermophilum complexed with methyl thioxylopentoside

PDB Compounds: (B:) endoxylanase 11A

SCOP Domain Sequences for d1xnkb1:

Sequence; same for both SEQRES and ATOM records:

>d1xnkb1 b.29.1.11 (B:1-191) Xylanase II {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

Timeline for d1xnkb1:

• d1xnkb1 is new in SCOP 1.73
  
• d1xnkb1 appears in SCOP 1.75
  
• d1xnkb1 appears in the current release, SCOPe 2.08, called d1xnkb_