Lineage for d1xnka1 (1xnk A:1-191)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664114Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 664158Species Chaetomium thermophilum [TaxId:209285] [89272] (2 PDB entries)
    endoxylanase 11a
  8. 664159Domain d1xnka1: 1xnk A:1-191 [122195]
    automatically matched to d1h1aa_
    complexed with so4, xs2

Details for d1xnka1

PDB Entry: 1xnk (more details), 1.55 Å

PDB Description: beta-1,4-xylanase from chaetomium thermophilum complexed with methyl thioxylopentoside
PDB Compounds: (A:) endoxylanase 11A

SCOP Domain Sequences for d1xnka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnka1 b.29.1.11 (A:1-191) Xylanase II {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

SCOP Domain Coordinates for d1xnka1:

Click to download the PDB-style file with coordinates for d1xnka1.
(The format of our PDB-style files is described here.)

Timeline for d1xnka1:

Domains from other chains:
(mouse over for more information)
d1xnkb1