Lineage for d1xnka_ (1xnk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780282Species Chaetomium thermophilum [TaxId:209285] [186858] (1 PDB entry)
  8. 2780283Domain d1xnka_: 1xnk A: [122195]
    automated match to d1h1aa_
    complexed with so4

Details for d1xnka_

PDB Entry: 1xnk (more details), 1.55 Å

PDB Description: beta-1,4-xylanase from chaetomium thermophilum complexed with methyl thioxylopentoside
PDB Compounds: (A:) endoxylanase 11A

SCOPe Domain Sequences for d1xnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnka_ b.29.1.11 (A:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

SCOPe Domain Coordinates for d1xnka_:

Click to download the PDB-style file with coordinates for d1xnka_.
(The format of our PDB-style files is described here.)

Timeline for d1xnka_: