Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Chaetomium thermophilum [TaxId:209285] [186858] (1 PDB entry) |
Domain d1xnka_: 1xnk A: [122195] automated match to d1h1aa_ complexed with so4 |
PDB Entry: 1xnk (more details), 1.55 Å
SCOPe Domain Sequences for d1xnka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnka_ b.29.1.11 (A:) automated matches {Chaetomium thermophilum [TaxId: 209285]} etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy yssgsatvnvg
Timeline for d1xnka_: