SCOPe 2.08: Domain d1xnjb3: 1xnj B:34-228

Lineage for d1xnjb3 (1xnj B:34-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)
   Uniprot O43252 34-228

8. Domain d1xnjb3: 1xnj B:34-228 [122194]
   Other proteins in same PDB: d1xnja1, d1xnja2, d1xnjb1, d1xnjb2
   automated match to d1x6va3
   complexed with adp, adx

Details for d1xnjb3

PDB Entry: 1xnj, 1.98 Å

PDB Description: aps complex of human paps synthetase 1

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xnjb3:

Sequence; same for both SEQRES and ATOM records:

>d1xnjb3 c.37.1.4 (B:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Timeline for d1xnjb3:

• d1xnjb3 first appeared in SCOP 1.73
  
• d1xnjb3 appears in SCOPe 2.07