Lineage for d1xnja3 (1xnj A:34-228)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)
    Uniprot O43252 34-228
  8. Domain d1xnja3: 1xnj A:34-228 [122191]
    Other proteins in same PDB: d1xnja1, d1xnja2, d1xnjb1, d1xnjb2
    automated match to d1x6va3
    complexed with adp, adx

Details for d1xnja3

PDB Entry: 1xnj (more details), 1.98 Å

PDB Description: aps complex of human paps synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xnja3:

Sequence, based on SEQRES records: (download)

>d1xnja3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Sequence, based on observed residues (ATOM records): (download)

>d1xnja3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdapeyekpeapelvlktdscdvndcvqqvvellqerdivpv

SCOPe Domain Coordinates for d1xnja3 are not available.

Timeline for d1xnja3:

Domains from same chain:
(mouse over for more information)
d1xnja1, d1xnja2
Domains from other chains:
(mouse over for more information)
d1xnjb1, d1xnjb2, d1xnjb3