Lineage for d1xnja2 (1xnj A:390-624)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119529Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2119530Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2119553Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)
    Uniprot O43252 390-624
  8. 2119556Domain d1xnja2: 1xnj A:390-624 [122190]
    Other proteins in same PDB: d1xnja1, d1xnja3, d1xnjb1, d1xnjb3
    automated match to d1x6va2
    complexed with adp, adx

Details for d1xnja2

PDB Entry: 1xnj (more details), 1.98 Å

PDB Description: aps complex of human paps synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xnja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnja2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksleka

SCOPe Domain Coordinates for d1xnja2:

Click to download the PDB-style file with coordinates for d1xnja2.
(The format of our PDB-style files is described here.)

Timeline for d1xnja2: