Lineage for d1xnja1 (1xnj A:229-389)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564510Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1564511Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1564580Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 1564581Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 1564604Species Human (Homo sapiens) [TaxId:9606] [141702] (3 PDB entries)
    Uniprot O43252 229-389
  8. 1564607Domain d1xnja1: 1xnj A:229-389 [122189]
    Other proteins in same PDB: d1xnja2, d1xnja3, d1xnjb2, d1xnjb3
    automated match to d1x6va1
    complexed with adp, adx

Details for d1xnja1

PDB Entry: 1xnj (more details), 1.98 Å

PDB Description: aps complex of human paps synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnja1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereyl
qclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrk
eercarqwgttcknhpyikmvmeqgdwliggdlqvldrvyw

SCOPe Domain Coordinates for d1xnja1:

Click to download the PDB-style file with coordinates for d1xnja1.
(The format of our PDB-style files is described here.)

Timeline for d1xnja1: