SCOPe 2.07: Domain d1xnha_: 1xnh A:

Lineage for d1xnha_ (1xnh A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein automated matches [190257] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188123] (2 PDB entries)

8. Domain d1xnha_: 1xnh A: [122188]
   automated match to d1xnga1

Details for d1xnha_

PDB Entry: 1xnh, 2.3 Å

PDB Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1xnha_:

Sequence; same for both SEQRES and ATOM records:

>d1xnha_ c.26.2.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
yqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssvsm
penktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydyslk
sdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkppsa
dlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriqkn
afklelpaiak

Timeline for d1xnha_:

• d1xnha_ first appeared in SCOP 1.73, called d1xnha1
  
• d1xnha_ appears in SCOPe 2.06
  
• d1xnha_ appears in the current release, SCOPe 2.08