SCOP 1.73: Domain d1xnha1: 1xnh A:5-255

Lineage for d1xnha1 (1xnh A:5-255)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (7 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (3 species)

7. Species Helicobacter pylori [TaxId:210] [142084] (2 PDB entries)

8. Domain d1xnha1: 1xnh A:5-255 [122188]
   automatically matched to 1XNG A:3-257

Details for d1xnha1

PDB Entry: 1xnh, 2.3 Å

PDB Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOP Domain Sequences for d1xnha1:

Sequence; same for both SEQRES and ATOM records:

>d1xnha1 c.26.2.1 (A:5-255) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}
yqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssvsm
penktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydyslk
sdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkppsa
dlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriqkn
afklelpaiak

Timeline for d1xnha1:

• d1xnha1 is new in SCOP 1.73
  
• d1xnha1 appears in SCOP 1.75
  
• d1xnha1 appears in the current release, SCOPe 2.08, called d1xnha_