| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein automated matches [190257] (3 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [188123] (2 PDB entries) |
| Domain d1xngb_: 1xng B: [122187] Other proteins in same PDB: d1xnga1 automated match to d1xnga1 complexed with atp, dnd, mg |
PDB Entry: 1xng (more details), 1.7 Å
SCOPe Domain Sequences for d1xngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xngb_ c.26.2.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
knafklelpaiakrfnpelehh
Timeline for d1xngb_: