Lineage for d1xn3b_ (1xn3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800856Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2800857Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2800972Domain d1xn3b_: 1xn3 B: [122183]
    automated match to d1fkna_

Details for d1xn3b_

PDB Entry: 1xn3 (more details), 2 Å

PDB Description: Crystal structure of Beta-secretase bound to a long inhibitor with additional upstream residues.
PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d1xn3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn3b_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d1xn3b_:

Click to download the PDB-style file with coordinates for d1xn3b_.
(The format of our PDB-style files is described here.)

Timeline for d1xn3b_: