Lineage for d1xn3a1 (1xn3 A:45P-385)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672515Protein beta-secretase (memapsin) [50671] (1 species)
  7. 672516Species Human (Homo sapiens) [TaxId:9606] [50672] (30 PDB entries)
  8. 672534Domain d1xn3a1: 1xn3 A:45P-385 [122182]
    automatically matched to d1fkna_
    complexed with sta

Details for d1xn3a1

PDB Entry: 1xn3 (more details), 2 Å

PDB Description: Crystal structure of Beta-secretase bound to a long inhibitor with additional upstream residues.
PDB Compounds: (A:) Beta-secretase 1

SCOP Domain Sequences for d1xn3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn3a1 b.50.1.2 (A:45P-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOP Domain Coordinates for d1xn3a1:

Click to download the PDB-style file with coordinates for d1xn3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xn3a1: