Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries) |
Domain d1xmhb_: 1xmh B: [122160] Other proteins in same PDB: d1xmhc_, d1xmhd_, d1xmhe_, d1xmhf_ automated match to d1fz1a_ complexed with co has additional subdomain(s) that are not in the common domain |
PDB Entry: 1xmh (more details), 2.32 Å
SCOPe Domain Sequences for d1xmhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmhb_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli aqphvrgdklwtlddikrlncvfknpvkafn
Timeline for d1xmhb_: