Lineage for d1xmgb_ (1xmg B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990053Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 1990054Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 1990086Domain d1xmgb_: 1xmg B: [122154]
    Other proteins in same PDB: d1xmgc_, d1xmgd_, d1xmge_, d1xmgf_
    automated match to d1fz1a_
    complexed with ca

Details for d1xmgb_

PDB Entry: 1xmg (more details), 2.1 Å

PDB Description: Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath)
PDB Compounds: (B:) Methane monooxygenase component A alpha chain

SCOPe Domain Sequences for d1xmgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmgb_ a.25.1.2 (B:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkafn

SCOPe Domain Coordinates for d1xmgb_:

Click to download the PDB-style file with coordinates for d1xmgb_.
(The format of our PDB-style files is described here.)

Timeline for d1xmgb_: