Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) automatically mapped to Pfam PF08113 |
Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins) |
Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries) |
Domain d1xmec_: 1xme C: [122146] Other proteins in same PDB: d1xmea_, d1xmeb1, d1xmeb2 automated match to d1xmec1 complexed with bng, cu, cua, gol, has, hem |
PDB Entry: 1xme (more details), 2.3 Å
SCOPe Domain Sequences for d1xmec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmec_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d1xmec_: