![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) ![]() |
![]() | Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
![]() | Species Thermus thermophilus [TaxId:274] [81470] (5 PDB entries) |
![]() | Domain d1xmec1: 1xme C:2-34 [122146] Other proteins in same PDB: d1xmea_, d1xmeb1, d1xmeb2 automatically matched to d1ehkc_ complexed with bng, cu, cua, gol, has, hem |
PDB Entry: 1xme (more details), 2.3 Å
SCOPe Domain Sequences for d1xmec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmec1 f.23.9.1 (C:2-34) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d1xmec1: