Lineage for d1xmec1 (1xme C:2-34)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059752Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
  5. 1059753Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)
  6. 1059754Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 1059755Species Thermus thermophilus [TaxId:274] [81470] (5 PDB entries)
  8. 1059756Domain d1xmec1: 1xme C:2-34 [122146]
    Other proteins in same PDB: d1xmea_, d1xmeb1, d1xmeb2
    automatically matched to d1ehkc_
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmec1

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide IIA

SCOPe Domain Sequences for d1xmec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmec1 f.23.9.1 (C:2-34) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d1xmec1:

Click to download the PDB-style file with coordinates for d1xmec1.
(The format of our PDB-style files is described here.)

Timeline for d1xmec1: