![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries) |
![]() | Domain d1xmea_: 1xme A: [122143] Other proteins in same PDB: d1xmeb1, d1xmeb2, d1xmec_ automated match to d1ehka_ complexed with bng, cu, cua, gol, has, hem |
PDB Entry: 1xme (more details), 2.3 Å
SCOPe Domain Sequences for d1xmea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmea_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya iiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt lvqlfghlnpvpgwrlw
Timeline for d1xmea_: