Lineage for d1xmea1 (1xme A:14-562)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746107Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 746108Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 746109Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 746121Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 746122Species Thermus thermophilus [TaxId:274] [81437] (2 PDB entries)
  8. 746123Domain d1xmea1: 1xme A:14-562 [122143]
    Other proteins in same PDB: d1xmeb1, d1xmeb2, d1xmec1
    automatically matched to d1ehka_
    complexed with bng, cu, cua, gol, has, hem

Details for d1xmea1

PDB Entry: 1xme (more details), 2.3 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase polypeptide I

SCOP Domain Sequences for d1xmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
npvpgwrlw

SCOP Domain Coordinates for d1xmea1:

Click to download the PDB-style file with coordinates for d1xmea1.
(The format of our PDB-style files is described here.)

Timeline for d1xmea1: