Lineage for d1xm9a1 (1xm9 A:244-700)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006875Family a.118.1.24: Plakophilin 1 helical region [140833] (1 protein)
  6. 2006876Protein Plakophilin 1 [140834] (1 species)
  7. 2006877Species Human (Homo sapiens) [TaxId:9606] [140835] (1 PDB entry)
    Uniprot Q13835 244-721
  8. 2006878Domain d1xm9a1: 1xm9 A:244-700 [122142]
    isoform 1

Details for d1xm9a1

PDB Entry: 1xm9 (more details), 2.8 Å

PDB Description: Structure of the armadillo repeat domain of plakophilin 1
PDB Compounds: (A:) plakophilin 1

SCOPe Domain Sequences for d1xm9a1:

Sequence, based on SEQRES records: (download)

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}
gltipkavqylssqdekyqaigayyiqhtcfqdesakqqvyqlggicklvdllrspnqnv
qqaaagalrnlvfrsttnkletrrqngireavsllrrtgnaeiqkqltgllwnlsstdel
keeliadalpvladrviipfsgwcdgnsnmsrevvdpevffnatgclrnlssadagrqtm
rnysglidslmayvqncvaasrcddksvencmcvlhnlsyrldaevptryrqleynarna
yteksstgcfsnksdkmmnnnydcplpeeetnpkgsgwlyhsdairtylnlmgkskkdat
leacagalqnltaskglmssgmsqliglkekglpqiarllqsgnsdvvrsgasllsnmsr
hpllhrvmgnqvfpevtrlltshtgntsnsedilssacytvrnlmasqpqlakqyfsssm
lnniinlcrssaspkaaeaarlllsdmwsskelqgvl

Sequence, based on observed residues (ATOM records): (download)

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}
gltipkavqylssqdekyqaigayyiqhtcfqdesakqqvyqlggicklvdllrspnqnv
qqaaagalrnlvfrsttnkletrrqngireavsllrrtgnaeiqkqltgllwnlsstdel
keeliadalpvladrviipfsgwcvvdpevffnatgclrnlssadagrqtmrnysglids
lmayvqncvaasrcddksvencmcvlhnlsyrldaevptryrqleynalpeeetnpkgsg
wlyhsdairtylnlmgkskkdatleacagalqnltaskglmssgmsqliglkekglpqia
rllqsgnsdvvrsgasllsnmsrhpllhrvmgnqvfpevtrlltshtgntsnsedilssa
cytvrnlmasqpqlakqyfsssmlnniinlcrssaspkaaeaarlllsdmwsskelqgvl

SCOPe Domain Coordinates for d1xm9a1:

Click to download the PDB-style file with coordinates for d1xm9a1.
(The format of our PDB-style files is described here.)

Timeline for d1xm9a1: