![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.88: Mss4-like [51315] (1 superfamily) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (4 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.3: SelR domain [75041] (2 proteins) |
![]() | Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141671] (1 PDB entry) Uniprot P54155 1-143 |
![]() | Domain d1xm0a1: 1xm0 A:1-143 [122140] |
PDB Entry: 1xm0 (more details)
SCOP Domain Sequences for d1xm0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xm0a1 b.88.1.3 (A:1-143) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]} maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa lrfvpkhklkeegyesylhlfnk
Timeline for d1xm0a1: