Lineage for d1xm0a1 (1xm0 A:1-143)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811449Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 811450Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 811473Family b.88.1.3: SelR domain [75041] (2 proteins)
  6. 811478Protein Peptide methionine sulfoxide reductase MsrB [141670] (1 species)
  7. 811479Species Bacillus subtilis [TaxId:1423] [141671] (1 PDB entry)
    Uniprot P54155 1-143
  8. 811480Domain d1xm0a1: 1xm0 A:1-143 [122140]

Details for d1xm0a1

PDB Entry: 1xm0 (more details)

PDB Description: Solution NMR Structure of Methionine Sulfoxide Reductase B Using Minimal Constraint Strategy; Northeast Structural Genomics Target SR10
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrB

SCOP Domain Sequences for d1xm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xm0a1 b.88.1.3 (A:1-143) Peptide methionine sulfoxide reductase MsrB {Bacillus subtilis [TaxId: 1423]}
maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds
qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa
lrfvpkhklkeegyesylhlfnk

SCOP Domain Coordinates for d1xm0a1:

Click to download the PDB-style file with coordinates for d1xm0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xm0a1: