Lineage for d1xlwa1 (1xlw A:4-529)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 706660Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 706783Protein Butyryl cholinesterase [102612] (1 species)
  7. 706784Species Human (Homo sapiens) [TaxId:9606] [102613] (7 PDB entries)
  8. 706786Domain d1xlwa1: 1xlw A:4-529 [122139]
    automatically matched to d1p0ia_
    complexed with cl, dep, fuc, ful, gol, nag, s, so4; mutant

Details for d1xlwa1

PDB Entry: 1xlw (more details), 2.1 Å

PDB Description: diethylphosphorylated butyrylcholinesterase (nonaged) obtained by reaction with echothiophate
PDB Compounds: (A:) butyrylcholinesterase

SCOP Domain Sequences for d1xlwa1:

Sequence, based on SEQRES records: (download)

>d1xlwa1 c.69.1.1 (A:4-529) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnpqet
qnqstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

Sequence, based on observed residues (ATOM records): (download)

>d1xlwa1 c.69.1.1 (A:4-529) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfehrs
sklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnpqetqn
qstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOP Domain Coordinates for d1xlwa1:

Click to download the PDB-style file with coordinates for d1xlwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xlwa1: