Lineage for d1xlua1 (1xlu A:4-529)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 841868Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 842016Protein Butyryl cholinesterase [102612] (1 species)
  7. 842017Species Human (Homo sapiens) [TaxId:9606] [102613] (8 PDB entries)
  8. 842020Domain d1xlua1: 1xlu A:4-529 [122137]
    automatically matched to d1p0ia_
    complexed with cl, ful, gol, mip, nag, s, so4; mutant

Details for d1xlua1

PDB Entry: 1xlu (more details), 2.2 Å

PDB Description: x-ray structure of di-isopropyl-phosphoro-fluoridate (dfp) inhibited butyrylcholinesterase after aging
PDB Compounds: (A:) butyrylcholinesterase

SCOP Domain Sequences for d1xlua1:

Sequence, based on SEQRES records: (download)

>d1xlua1 c.69.1.1 (A:4-529) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnpqet
qnqstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

Sequence, based on observed residues (ATOM records): (download)

>d1xlua1 c.69.1.1 (A:4-529) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfehrs
sklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnpqetqn
qstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOP Domain Coordinates for d1xlua1:

Click to download the PDB-style file with coordinates for d1xlua1.
(The format of our PDB-style files is described here.)

Timeline for d1xlua1: