| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
| Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
| Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
| Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
| Domain d1xltd2: 1xlt D:1-143,D:327-378 [122128] Other proteins in same PDB: d1xlta1, d1xltb1, d1xltc2, d1xltc3, d1xltd1, d1xlte1, d1xltf2, d1xltf3, d1xltg1, d1xlth1, d1xlti2, d1xlti3 automatically matched to d1f8ga2 complexed with na, nad, ndp, suc |
PDB Entry: 1xlt (more details), 3.1 Å
SCOPe Domain Sequences for d1xltd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xltd2 c.23.12.2 (D:1-143,D:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa
Timeline for d1xltd2: