SCOP 1.73: Domain d1xlqc1: 1xlq C:1-106

Lineage for d1xlqc1 (1xlq C:1-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries)

8. Domain d1xlqc1: 1xlq C:1-106 [122121]
   automatically matched to d1oqra_
   complexed with fes; mutant

Details for d1xlqc1

PDB Entry: 1xlq, 1.45 Å

PDB Description: crystal structure of reduced c73s putidaredoxin from pseudomonas putida

PDB Compounds: (C:) putidaredoxin

SCOP Domain Sequences for d1xlqc1:

Sequence; same for both SEQRES and ATOM records:

>d1xlqc1 d.15.4.1 (C:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

Timeline for d1xlqc1:

• d1xlqc1 is new in SCOP 1.73
  
• d1xlqc1 appears in SCOP 1.75
  
• d1xlqc1 appears in the current release, SCOPe 2.08, called d1xlqc_