Lineage for d1xlqb_ (1xlq B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018450Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1018451Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1018494Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (13 PDB entries)
  8. 1018496Domain d1xlqb_: 1xlq B: [122120]
    automated match to d1oqra_
    complexed with fes

Details for d1xlqb_

PDB Entry: 1xlq (more details), 1.45 Å

PDB Description: crystal structure of reduced c73s putidaredoxin from pseudomonas putida
PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d1xlqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1xlqb_:

Click to download the PDB-style file with coordinates for d1xlqb_.
(The format of our PDB-style files is described here.)

Timeline for d1xlqb_: