Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (17 species) |
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (13 PDB entries) |
Domain d1xlqb_: 1xlq B: [122120] automated match to d1oqra_ complexed with fes |
PDB Entry: 1xlq (more details), 1.45 Å
SCOPe Domain Sequences for d1xlqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d1xlqb_: