Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
Protein 2Fe-2S ferredoxin [54294] (17 species) |
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries) |
Domain d1xlqb1: 1xlq B:1-106 [122120] automatically matched to d1oqra_ complexed with fes; mutant |
PDB Entry: 1xlq (more details), 1.45 Å
SCOP Domain Sequences for d1xlqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlqb1 d.15.4.1 (B:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d1xlqb1: