![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (19 species) |
![]() | Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries) |
![]() | Domain d1xlqa_: 1xlq A: [122119] automated match to d1oqra_ complexed with fes |
PDB Entry: 1xlq (more details), 1.45 Å
SCOPe Domain Sequences for d1xlqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlqa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d1xlqa_: