Lineage for d1xlpc_ (1xlp C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)
  8. Domain d1xlpc_: 1xlp C: [122118]
    automated match to d1oqra_
    complexed with fes

Details for d1xlpc_

PDB Entry: 1xlp (more details), 2 Å

PDB Description: Structure of oxidized C73S putidaredoxin from Pseudomonas putida
PDB Compounds: (C:) putidaredoxin

SCOPe Domain Sequences for d1xlpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlpc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1xlpc_ are not available.

Timeline for d1xlpc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xlpa_, d1xlpb_